PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.M01443.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family NF-YB
Protein Properties Length: 205aa    MW: 22478.3 Da    PI: 6.5037
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.M01443.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB173.42.4e-5427121195
             NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 
                       vreqdrf+Pianv+rim+k+lP +akis+daket+qecvse+isf+tsea+d+cqre+rkti+++d+lwa+++lGf+dy+epl+vyl++yre+
  Migut.M01443.1.p  27 VREQDRFMPIANVIRIMRKILPPHAKISDDAKETIQECVSEYISFITSEANDRCQREQRKTITAEDVLWAMSKLGFDDYIEPLTVYLHRYREF 119
                       69******************************************************************************************9 PP

             NF-YB  94 eg 95 
                       +g
  Migut.M01443.1.p 120 DG 121
                       87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.8E-5122125IPR009072Histone-fold
SuperFamilySSF471137.14E-3930128IPR009072Histone-fold
PfamPF008084.6E-263397IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.8E-176179No hitNo description
PROSITE patternPS0068506480IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.8E-178098No hitNo description
PRINTSPR006151.8E-1799117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MGLPSPQANN HHTAAAGGGA EDAECVVREQ DRFMPIANVI RIMRKILPPH AKISDDAKET  60
IQECVSEYIS FITSEANDRC QREQRKTITA EDVLWAMSKL GFDDYIEPLT VYLHRYREFD  120
GGERGSLRGE PLVKRVLDHG GGPMGFPGGY PAAAAFHHMA AHHHHHGFFG AAPPMNFFKD  180
PTNAGPSQAA VACVDPYPQC KEQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4csr_A2e-3928118494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B2e-3928118494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
1n1j_A2e-3928118393NF-YB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012849193.11e-153PREDICTED: nuclear transcription factor Y subunit B-1
SwissprotQ84W662e-66NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLA0A118JXB52e-95A0A118JXB5_CYNCS; Uncharacterized protein
STRINGVIT_00s0956g00020.t012e-85(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.21e-64nuclear factor Y, subunit B6